LL-37 Nasal Spray 5mg — 10 mL

Description LL-37 is a human cathelicidin-derived antimicrobial peptide. It is studied for its broad-spectrum activity against bacteria, viruses, and fungi, as well as its roles in immune modulation, wound repair, and inflammation balance.  Product Highlights Each vial contains 10 mL solution (~100 sprays) Each spray delivers 0.1 mL = 100 mcg LL-37 Total LL-37 Content: 10 mg per vial Specialized pharmaceutical-grade nasal solution — designed for comfort and ease on the nose Unlike many other nasal sprays, this formula avoids irritation and dryness Packaged in Class A, lead-free pharmaceutical glass bottles Tamper/Child-Proof Cap Orifice Reducer for integrity, sterility, and ease of use Description LL-37 is investigated for antimicrobial defense, immune regulation, wound healing, and inflammation control. It has been studied for roles in epithelial protection across skin, lung, and gastrointestinal systems. Benefits Broad-spectrum defense — studied for antimicrobial activity against bacteria, viruses, and fungi Immune modulation — explored for balancing innate and adaptive immune responses Wound healing — linked to angiogenesis and tissue regeneration research Anti-inflammatory — studied for calming excessive inflammatory signaling Barrier protection — interest in skin, lung, and gut epithelial defense Localized Effects with Nasal Spray Rapid uptake through the nasal mucosa Direct antimicrobial and immune-modulating effects in respiratory and systemic pathways Formulated with a specialized isotonic nasal vehicle to minimize irritation and dryness What Researchers Use It For Mechanism: cationic peptide disrupting microbial membranes and signaling immune pathways Role in epithelial defense of skin, lung, and gastrointestinal tract Angiogenesis and wound-healing effects in tissue models Exploration in sepsis, chronic infections, and autoimmune conditions Identity & Specs Sequence: [LL-37, 37 aa] Formula / M.W.: C215H358N64O46, ~4493 g/mol CAS: 221231-10-3 Form: Sterile nasal spray solution Net per vial: 10 mL (~100 sprays) Total Content: 10 mg LL-37 per vial Purity: ≥99% (HPLC) Identity: MS-verified (per COA) Storage: Refrigerate 2–8 °C, protect from light Selected Research PubChem entry — chemical identity: https://pubchem.ncbi.nlm.nih.gov/compound/16130166 Antimicrobial and immune roles of LL-37: https://pubmed.ncbi.nlm.nih.gov/12794199/ LL-37 in wound healing and angiogenesis: https://pubmed.ncbi.nlm.nih.gov/16489025/ Role in lung and epithelial defense: https://pubmed.ncbi.nlm.nih.gov/17923416/ LL-37 immune modulation overview: https://pubmed.ncbi.nlm.nih.gov/20193060/ ⚠️ Disclaimer This product is intended for laboratory research use only. Not for human or veterinary use. Not approved for diagnostic, therapeutic, or medical applications. Handle using appropriate laboratory safety procedures and personal protective equipment.